missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTMR14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | MTMR14 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18416561
|
Novus Biologicals
NBP2-33703-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18139593
|
Novus Biologicals
NBP2-33703 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MTMR14 Polyclonal specifically detects MTMR14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MTMR14 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C3orf29FLJ11546, chromosome 3 open reading frame 29, EC 3.1.3.-, egg-derived tyrosine phosphatase homolog, FLJ22405, FLJ46453, FLJ90311, HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, hEDTP, HJUMPY, jumpy, myotubularin related protein 14, myotubularin-related protein 14, NS5ATP4ABP1 | |
| MTMR14 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8NCE2 | |
| 64419 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title