missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myotubularin Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
Myotubularin Polyclonal antibody specifically detects Myotubularin in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | Myotubularin |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 405 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | CG2, CNM, EC 3.1.3.48, MTMX, myotubular myopathy 1, myotubularin, myotubularin 1, XLMTM |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 484-603 of human Myotubularin (NP_000243.1).,, Sequence:, SARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQTHF |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?