missing translation for 'onlineSavingsMsg'
Learn More
Learn More
N-Cadherin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
Brand: Novus Biologicals NBP2-38856
This item is not returnable.
View return policy
Description
N-Cadherin Polyclonal specifically detects N-Cadherin in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| N-Cadherin | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P19022 | |
| CDH2 | |
| This N-Cadherin Antibody was developed against a recombinant protein corresponding to amino acids: NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cadherin 2, N-cadherin (neuronal), cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, CD325, CD325 antigen, CDHNcalcium-dependent adhesion protein, neuronal, CDw325, N-cadherin, NCADN-cadherin 1, Neural cadherin, neural-cadherin | |
| Rabbit | |
| 100 kDa | |
| 0.1 mL | |
| Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Mesenchymal Stem Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction, Stem Cells | |
| 1000 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction