missing translation for 'onlineSavingsMsg'
Learn More
Learn More
N-Cadherin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
260.00 € - 571.00 €
Specifications
| Antigen | N-Cadherin |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18616405
|
Novus Biologicals
NBP2-38856-25ul |
25 μL |
260.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18096404
|
Novus Biologicals
NBP2-38856 |
0.1 mL |
571.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
N-Cadherin Polyclonal specifically detects N-Cadherin in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| N-Cadherin | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P19022 | |
| 1000 | |
| This N-Cadherin Antibody was developed against a recombinant protein corresponding to amino acids: NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Mesenchymal Stem Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction, Stem Cells | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cadherin 2, N-cadherin (neuronal), cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, CD325, CD325 antigen, CDHNcalcium-dependent adhesion protein, neuronal, CDw325, N-cadherin, NCADN-cadherin 1, Neural cadherin, neural-cadherin | |
| CDH2 | |
| IgG | |
| Affinity Purified | |
| 100 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title