missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NDUFS5 Polyclonal antibody specifically detects NDUFS5 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | NDUFS5 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 646 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | CI-15 kDa, CI-15k, CI15K, Complex I-15 kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 5 (15kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 5, NADH:ubiquinone oxidoreductase 15 kDa IP subunit, NADH-ubiquinone oxidoreductase 15 kDa subunit |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1).,, Sequence:, MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?