missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Neurabin 1 Antibody, Novus Biologicals™

Neurabin 1 Antibody, Novus Biologicals™

Product Code. 18616326 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18616326 100 μg 100µL
18683378 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18616326 Supplier Novus Biologicals Supplier No. NBP269010

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Neurabin 1 Polyclonal antibody specifically detects Neurabin 1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Neurabin 1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias KIAA1222NRBI, neurabin-1, Neurabin-IFLJ20068, Neural tissue-specific F-actin-binding protein I, NRB1, Protein phosphatase 1 regulatory subunit 9A, protein phosphatase 1, regulatory (inhibitor) subunit 9A
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS
Purification Method Protein A purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 55607
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.