missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neurexin 3/NRXN3 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93379-0.02ml
This item is not returnable.
View return policy
Description
Neurexin 3/NRXN3 Polyclonal antibody specifically detects Neurexin 3/NRXN3 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Neurexin 3/NRXN3 | |
| Polyclonal | |
| Western Blot 1:1000-1:2000 | |
| C14orf60, chromosome 14 open reading frame 60, KIAA0743MGC176711, neurexin 3, neurexin III, Neurexin III-alpha, Neurexin III-beta, neurexin-3-beta | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 373-432 of human NRXN3 (NP_620426.2). ILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV | |
| 0.02 mL | |
| Cell Biology, Neuroscience | |
| 9369 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction