missing translation for 'onlineSavingsMsg'
Learn More

NFIX Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™

Product Code. 30517328 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30517328 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30517328 Supplier Novus Biologicals Supplier No. NBP338606AF405

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NFIX Polyclonal antibody specifically detects NFIX in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NFIX
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 405
Formulation 50mM Sodium Borate
Gene Alias CTF, NF1ACCAAT-box-binding transcription factor, NF1-X, NF-I/X, NFI-X, nuclear factor 1 X-type, Nuclear factor 1/X, Nuclear factor I/X, nuclear factor I/X (CCAAT-binding transcription factor), TGGCA-binding protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NFIX (NP_002492.2).,, Sequence:, AYFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVT
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 4784
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.