missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NOX1 Polyclonal antibody specifically detects NOX1 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | NOX1 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:100 - 1:500, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | EC 1.6.3, GP91-2, Mitogenic oxidase 1, MOX-1, MOX1NADH/NADPH mitogenic oxidase subunit P65-MOX, NADPH oxidase 1, NADPH oxidase homolog-1, NOH1mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating), NOH-1NADPH oxidase 1 variant NOH-1L, NOX-1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NOX1 (NP_008983.2). YFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?