missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NPY4R Polyclonal antibody specifically detects NPY4R in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | NPY4R |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | neuropeptide Y receptor type 4, NPY4RMGC116897, pancreatic polypeptide receptor 1NPY4-R, PP1Y4 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human NPY4R (NP_005963.4).,, Sequence:, MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLI |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?