missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30515060

NPY4R Antibody [FITC], Novus Biologicals Biologicals™

Product Code. 30515060 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30515060 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30515060 Supplier Novus Biologicals Supplier No. NBP338511F

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NPY4R Polyclonal antibody specifically detects NPY4R in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NPY4R
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate FITC
Formulation PBS
Gene Alias neuropeptide Y receptor type 4, NPY4RMGC116897, pancreatic polypeptide receptor 1NPY4-R, PP1Y4
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human NPY4R (NP_005963.4).,, Sequence:, MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLI
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline GPCR, Neuroscience, Neurotransmission
Primary or Secondary Primary
Gene ID (Entrez) 5540
Target Species Human
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.