missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30517079

Nup153 Antibody [mFluor Violet 450 SE], Novus Biologicals Biologicals™

Product Code. 30517079 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30517079 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30517079 Supplier Novus Biologicals Supplier No. NBP338586MFV450

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Nup153 Polyclonal antibody specifically detects Nup153 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Nup153
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate mFluor Violet 450 SE
Formulation 50mM Sodium Borate
Gene Alias CG4453, Dmel\CG4453, dmNup153, dNup153, HNUP153, N153, nuclear pore complex protein hnup153,153 kDa nucleoporin, nuclear pore complex protein Nup153, nucleoporin 153kD, nucleoporin 153kDa, Nucleoporin Nup153, Nup 153, nup153, Nup153 Nucleoporin 153
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nup153 (NP_005115.2).,, Sequence:, FQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMR
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9972
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.