missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OLFM4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62720
This item is not returnable.
View return policy
Beschreibung
OLFM4 Polyclonal antibody specifically detects OLFM4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| OLFM4 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Antiapoptotic protein GW112, bA209J19.1, GC1, G-CSF-stimulated clone 1 protein, GW112hOLfD, hGC-1, KIAA4294, olfactomedin 4, olfactomedin-4, OlfD, OLM4, UNQ362 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN | |
| 100 μg | |
| Cancer | |
| 10562 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur