missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OLFM4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 559.00 €
Spezifikation
| Antigen | OLFM4 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18698018
|
Novus Biologicals
NBP2-62720-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18693018
|
Novus Biologicals
NBP2-62720 |
100 μg |
559.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
OLFM4 Polyclonal antibody specifically detects OLFM4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| OLFM4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol | |
| 10562 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Antiapoptotic protein GW112, bA209J19.1, GC1, G-CSF-stimulated clone 1 protein, GW112hOLfD, hGC-1, KIAA4294, olfactomedin 4, olfactomedin-4, OlfD, OLM4, UNQ362 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts