missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2X7/P2RX7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82738-25ul
This item is not returnable.
View return policy
Description
P2X7/P2RX7 Polyclonal specifically detects P2X7/P2RX7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| P2X7/P2RX7 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| P2RX7 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSR | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.7mg/mL | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| ATP receptor, MGC20089, P2X purinoceptor 7, P2X7P2X7 receptor, P2X7R, P2Z receptor, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 7, purinergic receptor P2X7 variant A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5027 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction