missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2X7/P2RX7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
386.00 € - 529.00 €
Specifications
| Antigen | P2X7/P2RX7 |
|---|---|
| Concentration | 0.7mg/mL |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18409730
|
Novus Biologicals
NBP1-82738-25ul |
25 μL |
386.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18291307
|
Novus Biologicals
NBP1-82738 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
P2X7/P2RX7 Polyclonal specifically detects P2X7/P2RX7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| P2X7/P2RX7 | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ATP receptor, MGC20089, P2X purinoceptor 7, P2X7P2X7 receptor, P2X7R, P2Z receptor, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 7, purinergic receptor P2X7 variant A | |
| P2RX7 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| 0.7mg/mL | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5027 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title