missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
P4HA2 Polyclonal antibody specifically detects P4HA2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | P4HA2 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 750 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | 2-oxoglutarate-4-dioxygenase subunit alpha-2, 4-PH alpha 2, 4-PH alpha-2, alpha polypeptide II, collagen prolyl 4-hydroxylase alpha(II), C-P4Halpha(II), EC 1.14.11.2, Procollagen-proline, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), prolyl 4-hydroxylase subunit alpha-2, prolyl 4-hydroxylase, alpha polypeptide II |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 239-333 of human P4HA2 (NP_004190.1).,, Sequence:, SHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEW |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?