missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PATJ Polyclonal antibody specifically detects PATJ in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | PATJ |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 700 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | channel-interacting PDZ domain protein, FLJ26982, hINADL, inactivation no after-potential D-like protein, Inadl protein, InaD-like, InaD-like (Drosophila), inaD-like protein, Pals1-associated tight junction protein, PATJCipp, PDZ domain protein, Protein associated to tight junctions |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-680 of human PATJ (NP_795352.2).,, Sequence:, MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSN |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?