missing translation for 'onlineSavingsMsg'
Learn More

PATJ Antibody [DyLight 594], Novus Biologicals Biologicals™

Product Code. 30516229 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30516229 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30516229 Supplier Novus Biologicals Supplier No. NBP338552DL594

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PATJ Polyclonal antibody specifically detects PATJ in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PATJ
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 594
Formulation 50mM Sodium Borate
Gene Alias channel-interacting PDZ domain protein, FLJ26982, hINADL, inactivation no after-potential D-like protein, Inadl protein, InaD-like, InaD-like (Drosophila), inaD-like protein, Pals1-associated tight junction protein, PATJCipp, PDZ domain protein, Protein associated to tight junctions
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-680 of human PATJ (NP_795352.2).,, Sequence:, MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSN
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 10207
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.