missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCDHA12 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00 € - 470.00 €
Specifications
| Antigen | PCDHA12 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18676991
|
Novus Biologicals
NBP2-94710-0.02ml |
0.02 mL |
188.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18665601
|
Novus Biologicals
NBP2-94710-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PCDHA12 Polyclonal antibody specifically detects PCDHA12 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| PCDHA12 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 56137 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| KIAA0345-like 2, MGC138485, MGC141932, PCDH-alpha-12, PCDH-ALPHA12, protocadherin alpha 12, protocadherin alpha-12 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 713-792 of human PCDHA12 (NP_114070.1). LTLLLYTALRCSAPPTVSRCAPGKPTLVCSSAVGSWSYSQQRRQRVCSAESPPKTDLMAFSPSLQLSREDCLNPPSEVSY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title