missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30487562

PDE1A Antibody [Alexa Fluor« 700], Novus Biologicals Biologicals™

Product Code. 30487562 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30487562 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30487562 Supplier Novus Biologicals Supplier No. NBP335143AF700

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PDE1A Polyclonal antibody specifically detects PDE1A in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PDE1A
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 700
Formulation 50mM Sodium Borate
Gene Alias 3'-5' cyclic nucleotide phosphodiesterase, 61 kDa Cam-PDE, calcium/calmodulin-dependent 3'-5'-cyclic nucleotide phosphodiesterase 1A, calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase, calmodulin-dependent phosphodiesterase, Cam-PDE 1A, EC 3.1.4, EC 3.1.4.17, hCam-1, HCAM1, HSPDE1A, MGC26303, phosphodiesterase 1A, calmodulin-dependent, phosphodiesterase-1A
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 446-545 of human PDE1A (NP_005010.2).,, Sequence:, EASKAETSSYVASSSTTIVGLHIADALRRSNTKGSMSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDETHS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5136
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.