missing translation for 'onlineSavingsMsg'
Learn More

Pea3 Antibody [Biotin], Novus Biologicals Biologicals™

Product Code. 30502137 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30502137 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30502137 Supplier Novus Biologicals Supplier No. NBP335390B

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Pea3 Polyclonal antibody specifically detects Pea3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Pea3
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Biotin
Formulation PBS
Gene Alias Adenovirus E1A enhancer-binding protein, E1A-FE1A enhancer binding protein, E1AFETS translocation variant 4, ets variant 4, ets variant gene 4 (E1A enhancer binding protein, E1AF), ets variant gene 4 (E1A enhancer-binding protein, E1AF), EWS protein/E1A enhancer binding protein chimera, PEA3, PEAS3, Polyomavirus enhancer activator 3 homolog, polyomavirus enhancer activator-3, Protein PEA3
Host Species Rabbit
Immunogen Recombinant Protein corresponding to a sequence within amino acids 1-284 of human Pea3 (NP_001977.1).,, Sequence:, KNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 2118
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.