missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Peptidase Inhibitor 16/PI16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-69019-25ul
This item is not returnable.
View return policy
Description
Peptidase Inhibitor 16/PI16 Polyclonal antibody specifically detects Peptidase Inhibitor 16/PI16 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Peptidase Inhibitor 16/PI16 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CRISP9, CRISP-9, Cysteine-rich secretory protein 9, dJ90K10.5, DKFZp586B1817, MGC45378, microseminoprotein, beta-binding protein, MSMBBP, peptidase inhibitor 16, PI-16, protease inhibitor 16, PSP94-binding protein, PSPBP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TGARELLPHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGG | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 221476 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu