missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Peptidase Inhibitor 16/PI16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
360.00 € - 515.00 €
Specifications
| Antigen | Peptidase Inhibitor 16/PI16 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18611049
|
Novus Biologicals
NBP2-69019-25ul |
25 μL |
360.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18636318
|
Novus Biologicals
NBP2-69019 |
100 μg |
515.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Peptidase Inhibitor 16/PI16 Polyclonal antibody specifically detects Peptidase Inhibitor 16/PI16 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Peptidase Inhibitor 16/PI16 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CRISP9, CRISP-9, Cysteine-rich secretory protein 9, dJ90K10.5, DKFZp586B1817, MGC45378, microseminoprotein, beta-binding protein, MSMBBP, peptidase inhibitor 16, PI-16, protease inhibitor 16, PSP94-binding protein, PSPBP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TGARELLPHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 221476 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title