missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Prostate and testis expressed protein 3 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05564-100ul
This item is not returnable.
View return policy
Description
Prostate and testis expressed protein 3 Polyclonal antibody specifically detects Prostate and testis expressed protein 3 in Human samples. It is validated for Western Blot
Specifications
| Prostate and testis expressed protein 3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| acrosomal vesicle protein HEL-127, HEL-127, PATE-DJ, PATE-like protein DJ, secreted TFP/Ly-6/uPAR protein PATE-DJ | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human Prostate and testis expressed protein 3 (NP_001123355.3). MNKHFLFLFLLYCLIVAVTSLQCITCHLRTRTDRCRRGFGVCTAQKGEACMLLRIYQRNTLQISYMVCQKFCRDMTFDLRNRTYVHTCCNYNYCNFKL | |
| 100 μg | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction