missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Prostate and testis expressed protein 3 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00 € - 463.00 €
Specifications
| Antigen | Prostate and testis expressed protein 3 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18625057
|
Novus Biologicals
NBP3-05564-100ul |
100 μg |
463.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18616686
|
Novus Biologicals
NBP3-05564-20ul |
20 μg |
188.00 €
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Prostate and testis expressed protein 3 Polyclonal antibody specifically detects Prostate and testis expressed protein 3 in Human samples. It is validated for Western BlotSpecifications
| Prostate and testis expressed protein 3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| acrosomal vesicle protein HEL-127, HEL-127, PATE-DJ, PATE-like protein DJ, secreted TFP/Ly-6/uPAR protein PATE-DJ | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS with 50% glycerol, pH7.3. | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human Prostate and testis expressed protein 3 (NP_001123355.3). MNKHFLFLFLLYCLIVAVTSLQCITCHLRTRTDRCRRGFGVCTAQKGEACMLLRIYQRNTLQISYMVCQKFCRDMTFDLRNRTYVHTCCNYNYCNFKL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title