missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pyridoxal Kinase/PDXK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88283
This item is not returnable.
View return policy
Description
Pyridoxal Kinase/PDXK Polyclonal antibody specifically detects Pyridoxal Kinase/PDXK in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Pyridoxal Kinase/PDXK | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| C21orf124, C21orf97, chromosome 21 open reading frame 124, DKFZp566A071, EC 2.7.1.35, FLJ21324, FLJ37311, MGC15873, MGC31754, MGC52346, PKHchromosome 21 open reading frame 97, PNKhuman pyridoxal kinase, EC 2.7.1.3510FLJ31940, PRED79, pyridoxal (pyridoxine, vitamin B6) kinase, pyridoxal kinase, pyridoxamine kinase, Pyridoxine kinase, vitamin B6 kinase | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL | |
| 0.1 mL | |
| metabolism | |
| 8566 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction