missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pyridoxal Kinase/PDXK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 572.00 €
Specifications
| Antigen | Pyridoxal Kinase/PDXK |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18481781
|
Novus Biologicals
NBP1-88283-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18442651
|
Novus Biologicals
NBP1-88283 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Pyridoxal Kinase/PDXK Polyclonal antibody specifically detects Pyridoxal Kinase/PDXK in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Pyridoxal Kinase/PDXK | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| metabolism | |
| PBS (pH 7.2) and 40% Glycerol | |
| 8566 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| C21orf124, C21orf97, chromosome 21 open reading frame 124, DKFZp566A071, EC 2.7.1.35, FLJ21324, FLJ37311, MGC15873, MGC31754, MGC52346, PKHchromosome 21 open reading frame 97, PNKhuman pyridoxal kinase, EC 2.7.1.3510FLJ31940, PRED79, pyridoxal (pyridoxine, vitamin B6) kinase, pyridoxal kinase, pyridoxamine kinase, Pyridoxine kinase, vitamin B6 kinase | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title