missing translation for 'onlineSavingsMsg'
Learn More

RBM14 Antibody [mFluor Violet 500 SE], Novus Biologicals Biologicals™

Product Code. 30494521 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30494521 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30494521 Supplier Novus Biologicals Supplier No. NBP338092MFV500

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

RBM14 Polyclonal antibody specifically detects RBM14 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen RBM14
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate mFluor Violet 500 SE
Formulation 50mM Sodium Borate
Gene Alias COAAMGC31756, Paraspeckle protein 2, PSP2DKFZp779J0927, RNA binding motif protein 14, RNA-binding motif protein 14, RNA-binding protein 14, RRM-containing coactivator activator/modulator, SIPMGC15912, Synaptotagmin-interacting protein, SYT-interacting protein, SYTIP1, TMEM137, transmembrane protein 137
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human RBM14 (NP_006319.1).,, Sequence:, VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 10432
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.