missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RBM14 Polyclonal antibody specifically detects RBM14 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | RBM14 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | mFluor Violet 500 SE |
| Formulation | 50mM Sodium Borate |
| Gene Alias | COAAMGC31756, Paraspeckle protein 2, PSP2DKFZp779J0927, RNA binding motif protein 14, RNA-binding motif protein 14, RNA-binding protein 14, RRM-containing coactivator activator/modulator, SIPMGC15912, Synaptotagmin-interacting protein, SYT-interacting protein, SYTIP1, TMEM137, transmembrane protein 137 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human RBM14 (NP_006319.1).,, Sequence:, VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?