missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30509468

RPA14 Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™

Product Code. 30509468 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30509468 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30509468 Supplier Novus Biologicals Supplier No. NBP338316AF405

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

RPA14 Polyclonal antibody specifically detects RPA14 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen RPA14
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 405
Formulation 50mM Sodium Borate
Gene Alias REPA3Replication factor A protein 3, replication protein A 14 kDa subunit, replication protein A3 (14kD), replication protein A3, 14kDa, RF-A protein 3, RP-A p14, RPA14
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 6-121 of human RPA14 (NP_002938.1).,, Sequence:, DLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Nucleotide Excision Repair, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6119
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.