missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RXFP4/GPCR142/GPR100 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94509-0.02ml
This item is not returnable.
View return policy
Description
RXFP4/GPCR142/GPR100 Polyclonal antibody specifically detects RXFP4/GPCR142/GPR100 in Human, Mouse samples. It is validated for Western Blot
Specifications
| RXFP4/GPCR142/GPR100 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| G protein-coupled receptor 100, GPCR142, GPR100, Relaxin-3 receptor-2, RLN3R2, RXFP4 relaxin/insulin-like family peptide receptor 4, RXFPR4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 305-374 of human RXFP4 (NP_871001.1). NPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG | |
| 0.02 mL | |
| GPCR | |
| 339403 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction