missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCOT2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93673-0.02ml
This item is not returnable.
View return policy
Description
SCOT2 Polyclonal antibody specifically detects SCOT2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence
Specifications
| SCOT2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| 3-oxoacid CoA transferase 2, 3-oxoacid-CoA transferase 2A, EC 2.8.3, EC 2.8.3.5, FKSG25, FLJ00030, SCmitochondrial, SCOT-T, testis-specific succinyl CoA:3-oxoacid CoA-transferase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1). QKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLR | |
| 0.02 mL | |
| Lipid and Metabolism | |
| 64064 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction