missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCOT2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00 € - 470.00 €
Specifications
| Antigen | SCOT2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18603131
|
Novus Biologicals
NBP2-93673-0.02ml |
0.02 mL |
188.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18666871
|
Novus Biologicals
NBP2-93673-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SCOT2 Polyclonal antibody specifically detects SCOT2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ ImmunofluorescenceSpecifications
| SCOT2 | |
| Western Blot, Immunohistochemistry, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.3), 50% glycerol | |
| 64064 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| 3-oxoacid CoA transferase 2, 3-oxoacid-CoA transferase 2A, EC 2.8.3, EC 2.8.3.5, FKSG25, FLJ00030, SCmitochondrial, SCOT-T, testis-specific succinyl CoA:3-oxoacid CoA-transferase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1). QKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title