missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SF2 Polyclonal antibody specifically detects SF2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | SF2 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | Alternative-splicing factor 1, ASFpre-mRNA-splicing factor SF2, P33 subunit, MGC5228, serine/arginine-rich splicing factor 1, SF2FLJ53078, SF2p33, SFRS1splicing factor 2, Splicing factor, arginine/serine-rich 1ASF-1, SR splicing factor 1, SRp30a |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-248 of human SF2 (NP_008855.1).,, Sequence:, GGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSP |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?