missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SF20/MYDGF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48856-25ul
This item is not returnable.
View return policy
Description
SF20/MYDGF Polyclonal antibody specifically detects SF20/MYDGF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SF20/MYDGF | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| C19orf10, chromosome 19 open reading frame 10, EUROIMAGE1875335, IL25, IL27, IL27w, interleukin 27 working designation, interleukin-25, Ly6elg, MYDGF, myeloid-derived growth factor, R33729_1, SF20, Stromal cell-derived growth factor SF20, UPF0556 protein C19orf10 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL | |
| 25 μL | |
| Innate Immunity | |
| 56005 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction