missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SGLT1/SLC5A1 Antibody [Janelia Fluor« 646], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
SGLT1/SLC5A1 Polyclonal antibody specifically detects SGLT1/SLC5A1 in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | SGLT1/SLC5A1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 646 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | D22S675, High affinity sodium-glucose cotransporter, Na+/glucose cotransporter 1, NAGTsodium/glucose cotransporter 1, SGLT1Na(+)/glucose cotransporter 1, solute carrier family 5 (sodium/glucose cotransporter), member 1, Solute carrier family 5 member 1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human SGLT1/SLC5A1 (NP_000334.1).,, Sequence:, ECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?