missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC22A2/OCT2 Monoclonal antibody specifically detects SLC22A2/OCT2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | SLC22A2/OCT2 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | CL0628 |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2), 40% Glycerol |
| Gene Alias | hOCT2, MGC32628, OCT2Organic cation transporter 2, solute carrier family 22 (organic cation transporter), member 2, solute carrier family 22 member 2 |
| Host Species | Mouse |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?