missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC23A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00 € - 624.00 €
Specifications
| Antigen | SLC23A1 |
|---|---|
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18426241
|
Novus Biologicals
NBP2-13318-25ul |
25ul |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18766963
|
Novus Biologicals
NBP2-13318 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC23A1 Polyclonal specifically detects SLC23A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC23A1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| hSVCT1, SLC23A2, Sodium-dependent vitamin C transporter 1, sodium-dependent vitamin C transporter-1, solute carrier family 23 (nucleobase transporters), member 1, solute carrier family 23 (nucleobase transporters), member 2, solute carrier family 23 member 1, SVCT1Na(+)/L-ascorbic acid transporter 1, Yolk sac permease-like molecule 3, YSPL3MGC22361 | |
| SLC23A1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9963 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: NTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETAS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title