missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A22 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94069-0.02ml
This item is not returnable.
View return policy
Description
SLC25A22 Polyclonal antibody specifically detects SLC25A22 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Gene Knock-Out
Specifications
| SLC25A22 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Knockout Validated | |
| EIEE3mitochondrial glutamate carrier 1, FLJ13044, GC1GC-1, Glutamate/H(+) symporter 1, NET44, solute carrier family 25 (mitochondrial carrier: glutamate), member 22, Solute carrier family 25 member 22 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1). KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunofluorescence, Gene Knock-Out | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 79751 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion