missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A22 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
201.00 € - 481.00 €
Specifications
| Antigen | SLC25A22 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Knockout Validated |
| Applications | Western Blot, Immunofluorescence, Gene Knock-Out |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18650932
|
Novus Biologicals
NBP2-94069-0.02ml |
0.02 mL |
201.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18686402
|
Novus Biologicals
NBP2-94069-0.1ml |
0.1 mL |
481.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC25A22 Polyclonal antibody specifically detects SLC25A22 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Gene Knock-OutSpecifications
| SLC25A22 | |
| Western Blot, Immunofluorescence, Gene Knock-Out | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| EIEE3mitochondrial glutamate carrier 1, FLJ13044, GC1GC-1, Glutamate/H(+) symporter 1, NET44, solute carrier family 25 (mitochondrial carrier: glutamate), member 22, Solute carrier family 25 member 22 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1). KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Knockout Validated | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 79751 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title