missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC25A23 Polyclonal specifically detects SLC25A23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | SLC25A23 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | APC2FLJ30339, calcium-binding mitochondrial carrier protein SCaMC-3, MCSC2, MGC2615, Mitochondrial ATP-Mg/Pi carrier protein 2, Mitochondrial Ca(2+)-dependent solute carrier protein 2, mitochondrial Ca2+-dependent solute carrier protein 2, SCaMC-3, SCAMC3, short calcium-binding mitochondrial carrier 3, Small calcium-binding mitochondrial carrier protein 3, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23, Solute carrier family 25 member 23 |
| Gene Symbols | SLC25A23 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLD |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?