missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC43A3 Polyclonal antibody specifically detects SLC43A3 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | SLC43A3 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | DKFZp762A227, EEG1, FOAP-13, likely ortholog of mouse embryonic epithelial gene 1, PRO1659, Protein FOAP-13, SEEEG-1, solute carrier family 43 member 3, solute carrier family 43, member 3 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFS |
| Purification Method | Protein A purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?