missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00 € - 572.00 €
Specifications
| Antigen | SLC6A15 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18476800
|
Novus Biologicals
NBP1-83867-25ul |
25 μL |
292.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18218086
|
Novus Biologicals
NBP1-83867 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC6A15 Polyclonal specifically detects SLC6A15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SLC6A15 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55117 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3 | |
| SLC6A15 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title