missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC7A9 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93638-0.1ml
This item is not returnable.
View return policy
Description
SLC7A9 Polyclonal antibody specifically detects SLC7A9 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence
Specifications
| SLC7A9 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| b(0+)AT, B(0+)-type amino acid transporter 1, BAT1, bo+ amino acid transporter, CSNU3, FLJ94301, Glycoprotein-associated amino acid transporter b0+AT1, solute carrier family 7 (cationic amino acid transporter, y+ system), member 9, Solute carrier family 7 member 9 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1). MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL | |
| 0.1 mL | |
| Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Signal Transduction | |
| 11136 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction