missing translation for 'onlineSavingsMsg'
Learn More

SLC7A9 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18685800 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18685800 0.1 mL 0.1mL
18667061 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18685800 Supplier Novus Biologicals Supplier No. NBP2936380.1ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SLC7A9 Polyclonal antibody specifically detects SLC7A9 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC7A9
Applications Western Blot, Immunohistochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias b(0+)AT, B(0+)-type amino acid transporter 1, BAT1, bo+ amino acid transporter, CSNU3, FLJ94301, Glycoprotein-associated amino acid transporter b0+AT1, solute carrier family 7 (cationic amino acid transporter, y+ system), member 9, Solute carrier family 7 member 9
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1). MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 11136
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.