missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC8A2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 470.00 €
Specifications
| Antigen | SLC8A2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18673460
|
Novus Biologicals
NBP2-93474-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18677511
|
Novus Biologicals
NBP2-93474-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC8A2 Polyclonal antibody specifically detects SLC8A2 in Human samples. It is validated for Western BlotSpecifications
| SLC8A2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| KIAA1087, Na(+)/Ca(2+)-exchange protein 2, Na+/Ca2+-exchanging protein Nac2, NCX2, sodium/calcium exchanger 2, sodium-calcium exchanger 2, solute carrier family 8 (sodium/calcium exchanger), member 2, solute carrier family 8 (sodium-calcium exchanger), member 2, solute carrier family 8 member 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human SLC8A2 (NP_055878.1). LMTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQGGEGNSTFYVDYRTEDGSAKAGSDYEYSEGT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6543 | |
| IgG | |
| Affinity purified |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto