missing translation for 'onlineSavingsMsg'
Learn More

SP-B/Surfactant Protein B Antibody, Novus Biologicals™

Product Code. 18699726 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18699726 25 μL 25µL
18679208 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18699726 Supplier Novus Biologicals Supplier No. NBP24935925ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SP-B/Surfactant Protein B Polyclonal antibody specifically detects SP-B/Surfactant Protein B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen SP-B/Surfactant Protein B
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias 18 kDa pulmonary-surfactant protein, 6 kDa protein, PSP-B, pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SFTB3, SFTP3, SMDP1, SP-B surfactant, pulmonary-associated protein B, surfactant protein B
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PLVIDYFQNQIDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLS
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6439
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.