missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPACA9 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00 € - 470.00 €
Specifications
| Antigen | SPACA9 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18626610
|
Novus Biologicals
NBP2-94689-0.02ml |
0.02 mL |
188.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18628140
|
Novus Biologicals
NBP2-94689-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
SPACA9 Polyclonal antibody specifically detects SPACA9 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifikationer
| SPACA9 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.3), 50% glycerol | |
| 140710 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| C20orf117, chromosome 20 open reading frame 117, dJ132F21.1, FLJ44670, hypothetical protein LOC140710, KIAA0889, SOGA, suppressor of glucose, autophagy associated 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 650-750 of human SOGA1 (NP_542194.2). AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel