missing translation for 'onlineSavingsMsg'
Learn More

SPC25 Antibody [DyLight 680], Novus Biologicals Biologicals™

Product Code. 30489630 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30489630 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30489630 Supplier Novus Biologicals Supplier No. NBP335159FR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SPC25 Polyclonal antibody specifically detects SPC25 in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SPC25
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 680
Formulation 50mM Sodium Borate
Gene Alias AD024, hSpc25, kinetochore protein Spc25, MGC22228,2600017H08Rik, SPBC25, SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae), spindle pole body component 25 homolog, spindle pole body component 25 homolog (S. cerevisiae)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-224 of human SPC25 (NP_065726.1).,, Sequence:, ANKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57405
Target Species Human
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.