missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SPC25 Polyclonal antibody specifically detects SPC25 in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | SPC25 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 680 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | AD024, hSpc25, kinetochore protein Spc25, MGC22228,2600017H08Rik, SPBC25, SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae), spindle pole body component 25 homolog, spindle pole body component 25 homolog (S. cerevisiae) |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-224 of human SPC25 (NP_065726.1).,, Sequence:, ANKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?