missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPO11 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93056-0.1ml
This item is not returnable.
View return policy
Description
SPO11 Polyclonal antibody specifically detects SPO11 in Rat samples. It is validated for Western Blot
Specifications
| SPO11 | |
| Polyclonal | |
| Western Blot 1:200-1:2000 | |
| Cancer/testis antigen 35, CT35MGC39953, meiotic recombination protein SPO11, SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae), SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae), SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 269-358 of human SPO11 (NP_937998.1). AIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI | |
| 0.1 mL | |
| DNA Repair, Editing and Processing Endonucleases | |
| 23626 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction