missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPO11 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 470.00 €
Specifications
| Antigen | SPO11 |
|---|---|
| Dilution | Western Blot 1:200-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18657070
|
Novus Biologicals
NBP2-93056-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18639950
|
Novus Biologicals
NBP2-93056-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SPO11 Polyclonal antibody specifically detects SPO11 in Rat samples. It is validated for Western BlotSpecifications
| SPO11 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| DNA Repair, Editing and Processing Endonucleases | |
| PBS (pH 7.3), 50% glycerol | |
| 23626 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Rat | |
| Cancer/testis antigen 35, CT35MGC39953, meiotic recombination protein SPO11, SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae), SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae), SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 269-358 of human SPO11 (NP_937998.1). AIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title